JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RNASE1

Description	Ribonuclease pancreatic

Gene and Protein Information

Gene ID	6035
Uniprot Accession IDs	P07998 B2R589 D3DS06 Q16830 Q16869 Q1KHR2 Q6ICS5 Q9UCB4 Q9UCB5
Ensembl ID	ENSG00000129538
Symbol	RIB1 RNS1 RAC1 RIB1 RNS1
Chromosome	14
Family	Belongs to the pancreatic ribonuclease family.
Sequence	MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	465207	RNASE1	ribonuclease A family member 1, pancreatic	9598	VGNC:6798	Inparanoid, OMA, EggNOG
Macaque	704676	RNASE1	ribonuclease A family member 1, pancreatic	9544		Inparanoid, OMA
Mouse	19752	Rnase1	ribonuclease, RNase A family, 1 (pancreatic)	10090	MGI:97919	Inparanoid, OMA, EggNOG
Dog	475395	LOC475395	ribonuclease pancreatic-like	9615		OMA, EggNOG
Horse	100058995	RNASE1	ribonuclease A family member 1, pancreatic	9796		Inparanoid, OMA, EggNOG
Cow	280720	BRB	brain ribonuclease	9913		OMA, EggNOG
Cow	280930	RNASE1	ribonuclease, RNase A family, 1 (pancreatic)	9913		Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.