JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

SRA1

Description	Steroid receptor RNA activator 1

Gene and Protein Information

Gene ID	10011
Uniprot Accession IDs	Q9HD15 Q6NVU9 Q8IXM1 Q9HD13 Q9HD14
Ensembl ID	ENSG00000213523
Symbol	SRA SRAP STRAA1 pp7684
Chromosome	5
Family	Belongs to the SRA1 family.
Sequence	MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	737402	SRA1	steroid receptor RNA activator 1	9598	VGNC:4181	OMA, EggNOG
Macaque	698169	SRA1	steroid receptor RNA activator 1	9544		Inparanoid, OMA, EggNOG
Mouse	24068	Sra1	steroid receptor RNA activator 1	10090	MGI:1344414	Inparanoid, EggNOG
Rat	252891	Sra1	steroid receptor RNA activator 1	10116	RGD:621148	Inparanoid, OMA, EggNOG
Dog	606944	SRA1	steroid receptor RNA activator 1	9615	VGNC:46788	Inparanoid, OMA, EggNOG
Horse	100072416	SRA1	steroid receptor RNA activator 1	9796	VGNC:23568	Inparanoid, OMA, EggNOG
Cow	780787	SRA1	steroid receptor RNA activator 1	9913	VGNC:35266	Inparanoid, OMA, EggNOG
Pig	100513784	SRA1	steroid receptor RNA activator 1	9823		OMA, EggNOG
Anole lizard	100561561	sra1	steroid receptor RNA activator 1	28377		Inparanoid, OMA, EggNOG
Xenopus	100135196	sra1	steroid receptor RNA activator 1	8364	XB-GENE-994039	Inparanoid, OMA, EggNOG
Zebrafish	415137	sra1	steroid receptor RNA activator 1	7955	ZDB-GENE-040625-6	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.