JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

SRPRB

Description	Signal recognition particle receptor subunit beta

Gene and Protein Information

Gene ID	58477
Uniprot Accession IDs	Q9Y5M8 Q6P595 Q8N2D8 SR-beta
Ensembl ID	ENSG00000144867
Symbol	APMCF1
Chromosome	3
Family	Belongs to the SRP receptor beta subunit family.
Sequence	MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIA

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	100610929	SRPRB	SRP receptor subunit beta	9598	VGNC:7126	OMA, EggNOG
Macaque	719024	SRPRB	SRP receptor beta subunit	9544		Inparanoid, OMA, EggNOG
Mouse	20818	Srprb	signal recognition particle receptor, B subunit	10090	MGI:102964	Inparanoid, EggNOG
Cow	100138613	SRPRB	SRP receptor subunit beta	9913	VGNC:35291	OMA, EggNOG
Pig	100523141	SRPRB	SRP receptor beta subunit	9823		OMA, EggNOG
Opossum	100617644	SRPRB	SRP receptor beta subunit	13616		Inparanoid, OMA, EggNOG
Platypus	100092127	SRPRB	SRP receptor beta subunit	9258		Inparanoid, EggNOG
Zebrafish	436845	srprb	SRP receptor subunit beta	7955	ZDB-GENE-040718-311	Inparanoid, OMA, EggNOG
Fruitfly	47283	SrpRbeta	Signal recognition particle receptor beta	7227	FBgn0011509	Inparanoid, EggNOG
S.cerevisiae	853702	SRP102	Signal recognition particle receptor subunit beta	4932	S000001637	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.