This is a demo store. No orders will be fulfilled.

CRYAA2

Description Alpha-crystallin A2 chain

Gene and Protein Information

Gene ID 102724652
Uniprot Accession IDs A0A140G945 E9PHE4
Ensembl ID ENSP00000482816
Symbol CRYAA CRYAA
Family Belongs to the small heat shock protein (HSP20) family.
Sequence
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.