JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Account

Settings

Language

྾

Home
Targets(Human)
SNRPB2

SNRPB2

Description	U2 small nuclear ribonucleoprotein B''

Gene and Protein Information

Gene ID	6629
Uniprot Accession IDs	P08579 B2R7J3 D3DW21 Q9UJD4 U2 snRNP B''
Ensembl ID	ENSG00000125870
Symbol	Msl1 U2B''
Chromosome	20
Family	Belongs to the RRM U1 A/B'' family.
Sequence	MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	458105	SNRPB2	small nuclear ribonucleoprotein polypeptide B2	9598	VGNC:9995	OMA, EggNOG
Mouse	20639	Snrpb2	U2 small nuclear ribonucleoprotein B	10090	MGI:104805	OMA, EggNOG
Rat	362223	Snrpb2	small nuclear ribonucleoprotein polypeptide B2	10116	RGD:1310194	OMA, EggNOG
Dog	477148	SNRPB2	small nuclear ribonucleoprotein polypeptide B2	9615		OMA, EggNOG
Horse	100050830	SNRPB2	small nuclear ribonucleoprotein polypeptide B2	9796	VGNC:23396	OMA, EggNOG
Cow	767873	SNRPB2	small nuclear ribonucleoprotein polypeptide B2	9913	VGNC:35077	OMA, EggNOG
Platypus	100078690	SNRPB2	small nuclear ribonucleoprotein polypeptide B2	9258		OMA, EggNOG

Protein Classes

PANTHER Classes
protein / nucleic acid binding / mRNA splicing factor / U2 small nuclear ribonucleoprotein B''

DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / U2 small nuclear ribonucleoprotein B''

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Related active small molecules

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.