JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CFP

Description	Properdin

Gene and Protein Information

Gene ID	5199
Uniprot Accession IDs	P27918 O15134 O15135 O15136 O75826
Ensembl ID	ENSG00000126759
Symbol	PFC BFD PFC PFD PROPERDIN
Chromosome	X
Sequence	MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	18636	Cfp	complement factor properdin	10090	MGI:97545	Inparanoid, OMA, EggNOG
Rat	299314	Cfp	complement factor properdin	10116	RGD:1594557	Inparanoid, OMA, EggNOG
Dog	491859	CFP	complement factor properdin	9615	VGNC:39179	Inparanoid, OMA, EggNOG
Horse	100051317	CFP	complement factor properdin	9796	VGNC:16467	Inparanoid, OMA, EggNOG
Cow	539605	CFP	complement factor properdin	9913	VGNC:27256	Inparanoid, OMA, EggNOG
Pig	100522293	CFP	complement factor properdin	9823		Inparanoid, OMA, EggNOG
Opossum	100017759	CFP	complement factor properdin	13616		Inparanoid, OMA, EggNOG
Platypus	100080161	CFP	complement factor properdin	9258		Inparanoid, OMA, EggNOG
Anole lizard	100562473	cfp	complement factor properdin	28377		Inparanoid, OMA
Zebrafish	100149189	si:ch73-237c6.1	si:ch73-237c6.1	7955	ZDB-GENE-081105-55	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.