JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

PFN1

Description	Profilin-1

Gene and Protein Information

Gene ID	5216
Uniprot Accession IDs	P07737 Q53Y44
Ensembl ID	ENSG00000108518
Symbol	ALS18
Chromosome	17
Family	Belongs to the profilin family.
Sequence	MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	748477	PFN1	profilin 1	9598	VGNC:9511	OMA, EggNOG
Macaque	710753	PFN1	profilin 1	9544		Inparanoid, OMA, EggNOG
Mouse	18643	Pfn1	profilin 1	10090	MGI:97549	Inparanoid, OMA, EggNOG
Rat	64303	Pfn1	profilin 1	10116	RGD:621825	Inparanoid, OMA, EggNOG
Dog	607397	PFN1	profilin 1	9615	VGNC:53432	Inparanoid, OMA, EggNOG
Horse	100061295	PFN1	profilin 1	9796		OMA, EggNOG
Cow	513895	PFN1	profilin 1	9913		OMA, EggNOG
Pig	100512494	PFN1	profilin 1	9823		Inparanoid, EggNOG
Opossum	100016522	PFN1	profilin 1	13616		Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.