JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

PTPN1

Description	Tyrosine-protein phosphatase non-receptor type 1

Gene and Protein Information

Gene ID	5770
Uniprot Accession IDs	P18031 Q5TGD8 Q9BQV9 Q9NQQ4
Ensembl ID	ENSG00000196396
Symbol	PTP1B PTP1B
Chromosome	20
Family	Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily.
Sequence	MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	469970	PTPN1	protein tyrosine phosphatase, non-receptor type 1	9598	VGNC:9943	OMA, EggNOG
Macaque	702016	PTPN1	protein tyrosine phosphatase, non-receptor type 1	9544		Inparanoid, OMA, EggNOG
Mouse	19246	Ptpn1	protein tyrosine phosphatase, non-receptor type 1	10090	MGI:97805	Inparanoid, OMA, EggNOG
Rat	24697	Ptpn1	protein tyrosine phosphatase, non-receptor type 1	10116	RGD:61965	Inparanoid, OMA, EggNOG
Dog	477263	PTPN1	protein tyrosine phosphatase, non-receptor type 1	9615	VGNC:45167	Inparanoid, OMA
Horse	100052066	PTPN1	protein tyrosine phosphatase, non-receptor type 1	9796	VGNC:22010	Inparanoid, OMA
Cow	508658	PTPN1	protein tyrosine phosphatase, non-receptor type 1	9913	VGNC:33529	Inparanoid, OMA
Pig	396667	PTPN1	protein tyrosine phosphatase, non-receptor type 1	9823		Inparanoid, OMA
Chicken	395688	PTPN1	protein tyrosine phosphatase, non-receptor type 1	9031	CGNC:6062	Inparanoid, OMA
Anole lizard		PTPN1	protein tyrosine phosphatase, non-receptor type 1 [Source:HGNC Symbol;Acc:HGNC:9642]	28377		Inparanoid, OMA
Xenopus	549875	ptpn1	protein tyrosine phosphatase, non-receptor type 1	8364	XB-GENE-950442	Inparanoid, OMA
Zebrafish	30081	ptpn1	protein tyrosine phosphatase, non-receptor type 1	7955	ZDB-GENE-980605-23	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.