The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
PTPN1
| Description |
Tyrosine-protein phosphatase non-receptor type 1
|
Gene and Protein Information
| Gene ID |
5770
|
| Uniprot Accession IDs |
P18031
Q5TGD8
Q9BQV9
Q9NQQ4
|
| Ensembl ID |
ENSG00000196396
|
| Symbol |
PTP1B
PTP1B
|
| Chromosome |
20
|
| Family |
Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily. |
| Sequence |
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
Show more
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
469970 |
PTPN1 |
protein tyrosine phosphatase, non-receptor type 1 |
9598 |
VGNC:9943 |
OMA, EggNOG |
| Macaque |
702016 |
PTPN1 |
protein tyrosine phosphatase, non-receptor type 1 |
9544 |
|
Inparanoid, OMA, EggNOG |
| Mouse |
19246 |
Ptpn1 |
protein tyrosine phosphatase, non-receptor type 1 |
10090 |
MGI:97805 |
Inparanoid, OMA, EggNOG |
| Rat |
24697 |
Ptpn1 |
protein tyrosine phosphatase, non-receptor type 1 |
10116 |
RGD:61965 |
Inparanoid, OMA, EggNOG |
| Dog |
477263 |
PTPN1 |
protein tyrosine phosphatase, non-receptor type 1 |
9615 |
VGNC:45167 |
Inparanoid, OMA |
| Horse |
100052066 |
PTPN1 |
protein tyrosine phosphatase, non-receptor type 1 |
9796 |
VGNC:22010 |
Inparanoid, OMA |
| Cow |
508658 |
PTPN1 |
protein tyrosine phosphatase, non-receptor type 1 |
9913 |
VGNC:33529 |
Inparanoid, OMA |
| Pig |
396667 |
PTPN1 |
protein tyrosine phosphatase, non-receptor type 1 |
9823 |
|
Inparanoid, OMA |
| Chicken |
395688 |
PTPN1 |
protein tyrosine phosphatase, non-receptor type 1 |
9031 |
CGNC:6062 |
Inparanoid, OMA |
| Anole lizard |
|
PTPN1 |
protein tyrosine phosphatase, non-receptor type 1 [Source:HGNC Symbol;Acc:HGNC:9642] |
28377 |
|
Inparanoid, OMA |
| Xenopus |
549875 |
ptpn1 |
protein tyrosine phosphatase, non-receptor type 1 |
8364 |
XB-GENE-950442 |
Inparanoid, OMA |
| Zebrafish |
30081 |
ptpn1 |
protein tyrosine phosphatase, non-receptor type 1 |
7955 |
ZDB-GENE-980605-23 |
Inparanoid, OMA |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.