This is a demo store. No orders will be fulfilled.

DPEP3

Description Dipeptidase 3

Gene and Protein Information

Gene ID 64180
Uniprot Accession IDs Q9H4B8 B3KQ48 Q6PEZ5 Q6UXE4
Ensembl ID ENSG00000141096
Symbol MBD3
Chromosome 16
Family Belongs to the metallo-dependent hydrolases superfamily. Peptidase M19 family.
Sequence
MQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 468006 DPEP3 dipeptidase 3 9598 VGNC:5752 OMA, EggNOG
Macaque 701327 DPEP3 dipeptidase 3 9544 Inparanoid, OMA, EggNOG
Mouse 71854 Dpep3 dipeptidase 3 10090 MGI:1919104 Inparanoid, OMA, EggNOG
Rat 364994 Dpep3 dipeptidase 3 10116 RGD:1305484 Inparanoid, OMA, EggNOG
Horse 100066409 DPEP3 dipeptidase 3 9796 VGNC:17284 Inparanoid, OMA
Chicken 107054267 DPEP2 dipeptidase 2 9031 CGNC:77247 Inparanoid, OMA

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.