JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

PSMA1

Description	Proteasome subunit alpha type-1

Gene and Protein Information

Gene ID	5682
Uniprot Accession IDs	P25786 A8K400 Q53YE8 Q9BRV9
Ensembl ID	ENSG00000129084
Symbol	HC2 NU PROS30 PSC2 NU HC2 PROS30 HEL-S-275
Chromosome	11
Family	Belongs to the peptidase T1A family.
Sequence	MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	451040	PSMA1	proteasome subunit alpha 1	9598	VGNC:1037	OMA, EggNOG
Macaque	701029	PSMA1	proteasome subunit alpha 1	9544		Inparanoid, OMA, EggNOG
Mouse	26440	Psma1	proteasome (prosome, macropain) subunit, alpha type 1	10090	MGI:1347005	Inparanoid, OMA, EggNOG
Rat	29668	Psma1	proteasome subunit alpha 1	10116	RGD:61841	Inparanoid, OMA, EggNOG
Horse	100056224	PSMA1	proteasome subunit alpha 1	9796		Inparanoid, OMA, EggNOG
Cow	515503	PSMA1	proteasome subunit alpha 1	9913		Inparanoid, OMA, EggNOG
Pig	100516779	PSMA1	proteasome subunit alpha 1	9823		OMA, EggNOG
Opossum	100029192	PSMA1	proteasome subunit alpha 1	13616		OMA, EggNOG
Platypus	100093532	PSMA1	proteasome subunit alpha 1	9258		OMA, EggNOG
Chicken	395874	PSMA1	proteasome subunit alpha 1	9031	CGNC:4513	Inparanoid, OMA
Anole lizard	100565392	psma1	proteasome subunit alpha 1	28377		OMA, EggNOG
Xenopus		psma1	proteasome subunit alpha 1 [Source:Xenbase;Acc:XB-GENE-995831]	8364		OMA, EggNOG
Zebrafish	445033	psma1	proteasome subunit alpha 1	7955	ZDB-GENE-040801-15	Inparanoid, OMA
C. elegans	178943	pas-6	Proteasome subunit alpha type-1	6239		Inparanoid, OMA
S.cerevisiae	855362	PRE5	proteasome core particle subunit alpha 6	4932	S000004931	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.