The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
PTGES
| Description |
Prostaglandin E synthase
|
Gene and Protein Information
| Gene ID |
9536
|
| Uniprot Accession IDs |
O14684
O14900
Q5SZC0
|
| Ensembl ID |
ENSG00000148344
|
| Symbol |
MGST1L1
MPGES1
PGES
PIG12
PGES
MPGES
PIG12
PP102
PP1294
MGST-IV
MGST1L1
TP53I12
mPGES-1
MGST1-L1
|
| Chromosome |
9
|
| Family |
Belongs to the MAPEG family. |
| Sequence |
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
473071 |
PTGES |
prostaglandin E synthase |
9598 |
VGNC:4836 |
OMA, EggNOG |
| Macaque |
716657 |
PTGES |
prostaglandin E synthase |
9544 |
|
Inparanoid, OMA, EggNOG |
| Mouse |
64292 |
Ptges |
prostaglandin E synthase |
10090 |
MGI:1927593 |
Inparanoid, OMA, EggNOG |
| Rat |
59103 |
Ptges |
prostaglandin E synthase |
10116 |
RGD:62076 |
Inparanoid, OMA, EggNOG |
| Dog |
480698 |
PTGES |
prostaglandin E synthase |
9615 |
VGNC:45145 |
Inparanoid, OMA, EggNOG |
| Horse |
100034143 |
PTGES |
prostaglandin E synthase |
9796 |
VGNC:21990 |
Inparanoid, OMA, EggNOG |
| Cow |
282019 |
PTGES |
prostaglandin E synthase |
9913 |
VGNC:33505 |
Inparanoid, OMA, EggNOG |
| Pig |
654407 |
PTGES |
prostaglandin E synthase |
9823 |
|
Inparanoid, OMA, EggNOG |
| Opossum |
100015030 |
PTGES |
prostaglandin E synthase |
13616 |
|
Inparanoid, EggNOG |
| Platypus |
|
PTGES |
prostaglandin E synthase [Source:HGNC Symbol;Acc:HGNC:9599] |
9258 |
|
OMA, EggNOG |
| Anole lizard |
100556359 |
ptges |
prostaglandin E synthase |
28377 |
|
Inparanoid, OMA, EggNOG |
| Xenopus |
100038203 |
ptges |
prostaglandin E synthase |
8364 |
XB-GENE-484896 |
Inparanoid, OMA, EggNOG |
| Zebrafish |
544666 |
ptges |
prostaglandin E synthase |
7955 |
ZDB-GENE-050407-2 |
Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.