JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CENPA

Description	Histone H3-like centromeric protein A

Gene and Protein Information

Gene ID	1058
Uniprot Accession IDs	P49450 D6W544 Q53T74 Q9BVW2
Ensembl ID	ENSG00000115163
Symbol	CenH3 CENP-A
Chromosome	2
Family	Belongs to the histone H3 family.
Sequence	MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	459086	CENPA	centromere protein A	9598	VGNC:191	OMA, EggNOG
Macaque	697312	CENPA	centromere protein A	9544		Inparanoid, OMA
Mouse	12615	Cenpa	centromere protein A	10090	MGI:88375	Inparanoid, OMA, EggNOG
Rat	298850	Cenpa	centromere protein A	10116	RGD:1563607	Inparanoid, OMA, EggNOG
Dog	475692	CENPA	centromere protein A	9615	VGNC:39101	Inparanoid, OMA, EggNOG
Horse	100055617	CENPA	centromere protein A	9796	VGNC:16392	Inparanoid, OMA, EggNOG
Cow	782601	LOC782601	histone H3-like centromeric protein A	9913		OMA, EggNOG
Opossum	100030899	CENPA	centromere protein A	13616		Inparanoid, EggNOG
Anole lizard	100552579	LOC100552579	histone H3-like centromeric protein A	28377		OMA, EggNOG
Xenopus	549339	cenpa	centromere protein A	8364	XB-GENE-484234	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.