JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RAB5A

Description	Ras-related protein Rab-5A

Gene and Protein Information

Gene ID	5868
Uniprot Accession IDs	P20339 B4DJA5 Q6FI44
Ensembl ID	ENSG00000144566
Symbol	RAB5 RAB5
Chromosome	3
Family	Belongs to the small GTPase superfamily. Rab family.
Sequence	MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	460217	RAB5A	RAB5A, member RAS oncogene family	9598	VGNC:9693	OMA, EggNOG
Macaque	697712	RAB5A	RAB5A, member RAS oncogene family	9544		Inparanoid, OMA, EggNOG
Mouse	271457	Rab5a	RAB5A, member RAS oncogene family	10090	MGI:105926	Inparanoid, OMA, EggNOG
Dog	404008	RAB5A	RAB5A, member RAS oncogene family	9615	VGNC:45291	Inparanoid, OMA, EggNOG
Horse	100051997	RAB5A	RAB5A, member RAS oncogene family	9796	VGNC:22124	Inparanoid, OMA, EggNOG
Cow	539764	RAB5A	RAB5A, member RAS oncogene family	9913	VGNC:33658	Inparanoid, OMA
Opossum	100024447	RAB5A	RAB5A, member RAS oncogene family	13616		Inparanoid, OMA, EggNOG
Platypus		RAB5A	RAB5A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9783]	9258		OMA, EggNOG
Chicken	420649	RAB5A	RAB5A, member RAS oncogene family	9031	CGNC:51310	Inparanoid, OMA, EggNOG
Anole lizard	100552994	rab5a	RAB5A, member RAS oncogene family	28377		Inparanoid, OMA
Xenopus	493430	rab5a	RAB5A, member RAS oncogene family	8364	XB-GENE-482011	Inparanoid, OMA, EggNOG
Zebrafish	337737	rab5aa	RAB5A, member RAS oncogene family, a	7955	ZDB-GENE-030131-139	OMA, EggNOG
Zebrafish	393945	rab5ab	RAB5A, member RAS oncogene family, b	7955	ZDB-GENE-040122-3	Inparanoid, OMA
S.cerevisiae	853884	YPT52	Rab family GTPase YPT52	4932	S000001722	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.