JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RAP1B

Description	Ras-related protein Rap-1b

Gene and Protein Information

Gene ID	5908
Uniprot Accession IDs	P61224 B2R5Z2 B4DQI8 B4DW74 B4DW94 P09526 Q502X3 Q5TZR4 Q6DCA1 Q6LES0
Ensembl ID	ENSG00000127314
Symbol	K-REV RAL1B
Chromosome	12
Family	Belongs to the small GTPase superfamily. Ras family.
Sequence	MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	452065	RAP1B	RAP1B, member of RAS oncogene family	9598	VGNC:10515	Inparanoid, OMA, EggNOG
Macaque	718171	RAP1B	RAP1B, member of RAS oncogene family	9544		Inparanoid, OMA, EggNOG
Mouse	215449	Rap1b	RAS related protein 1b	10090	MGI:894315	Inparanoid, OMA, EggNOG
Rat	171337	Rap1b	RAP1B, member of RAS oncogene family	10116	RGD:620577	Inparanoid, OMA
Dog	608981	RAP1B	RAP1B, member of RAS oncogene family	9615		Inparanoid, OMA, EggNOG
Horse	100052025	RAP1B	RAP1B, member of RAS oncogene family	9796		Inparanoid, OMA
Horse	100058930	RAP1A	RAP1A, member of RAS oncogene family	9796		OMA, EggNOG
Cow	327708	RAP1B	RAP1B, member of RAS oncogene family	9913		Inparanoid, OMA
Opossum	100014092	RAP1B	RAP1B, member of RAS oncogene family	13616		Inparanoid, OMA, EggNOG
Platypus	100079331	RAP1B	RAP1B, member of RAS oncogene family	9258		Inparanoid, OMA, EggNOG
Chicken	417840	RAP1B	RAP1B, member of RAS oncogene family	9031	CGNC:50604	Inparanoid, OMA, EggNOG
Xenopus	493557	rap1b	RAP1B, member of RAS oncogene family	8364	XB-GENE-479036	Inparanoid, OMA
Xenopus	100124947	rap1a	RAP1A, member of RAS oncogene family	8364	XB-GENE-5801166	OMA, EggNOG
Zebrafish	321107	rap1b	RAP1B, member of RAS oncogene family	7955	ZDB-GENE-030131-9662	Inparanoid, OMA
Zebrafish	406714	rap1ab	RAP1A, member of RAS oncogene family b	7955	ZDB-GENE-040426-2738	OMA, EggNOG
C. elegans	177709	rap-1	Ras-related protein Rap-1	6239		OMA, EggNOG
Fruitfly	38244	Rap1	Rap1 GTPase	7227	FBgn0004636	Inparanoid, EggNOG
S.cerevisiae	853056	RSR1	Ras family GTPase RSR1	4932	S000003384	OMA, EggNOG

PANTHER Classes
protein / enzyme modulator / small GTPase / Ras-related protein Rap-1b

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Ras-related protein Rap-1b

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.