JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RAP2C

Description	Ras-related protein Rap-2c

Gene and Protein Information

Gene ID	57826
Uniprot Accession IDs	Q9Y3L5 B3KWD6 Q5H9H9 Q9BTS0
Ensembl ID	ENSG00000123728
Chromosome	X
Family	Belongs to the small GTPase superfamily. Ras family.
Sequence	MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	72065	Rap2c	RAP2C, member of RAS oncogene family	10090	MGI:1919315	Inparanoid, OMA
Rat	302495	Rap2c	RAP2C, member of RAS oncogene family	10116	RGD:1588562	Inparanoid, OMA
Dog	481054	RAP2C	RAP2C, member of RAS oncogene family	9615	VGNC:45345	Inparanoid, OMA
Horse	100054364	RAP2C	RAP2C, member of RAS oncogene family	9796	VGNC:22178	Inparanoid, OMA
Cow	515181	RAP2C	RAP2C, member of RAS oncogene family	9913	VGNC:33721	Inparanoid, OMA
Opossum	100022678	RAP2C	RAP2C, member of RAS oncogene family	13616		Inparanoid, OMA
Platypus	100084311	RAP2C	RAP2C, member of RAS oncogene family	9258		Inparanoid, OMA
Chicken	422232	RAP2C	RAP2C, member of RAS oncogene family	9031	CGNC:51667	Inparanoid, OMA
Xenopus	549652	rap2c	RAP2C, member of RAS oncogene family	8364	XB-GENE-489027	Inparanoid, OMA
Zebrafish	474323	rap2c	RAP2C, member of RAS oncogene family	7955	ZDB-GENE-041024-1	Inparanoid, OMA

PANTHER Classes
protein / enzyme modulator / small GTPase / Ras-related protein Rap-2c

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Ras-related protein Rap-2c

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.