JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RAB20

Description	Ras-related protein Rab-20

Gene and Protein Information

Gene ID	55647
Uniprot Accession IDs	Q9NX57 Q5T9X5 Q9NX49
Ensembl ID	ENSG00000139832
Chromosome	13
Family	Belongs to the small GTPase superfamily. Rab family.
Sequence	MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	19332	Rab20	RAB20, member RAS oncogene family	10090	MGI:102789	Inparanoid, OMA, EggNOG
Rat	689377	Rab20	RAB20, member RAS oncogene family	10116	RGD:1593487	Inparanoid, OMA, EggNOG
Dog	485549	RAB20	RAB20, member RAS oncogene family	9615	VGNC:45260	Inparanoid, OMA, EggNOG
Horse		RAB20	RAB20, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:18260]	9796		OMA, EggNOG
Cow	615760	RAB20	RAB20, member RAS oncogene family	9913	VGNC:33627	Inparanoid, OMA, EggNOG
Pig	100737446	RAB20	RAB20, member RAS oncogene family	9823		OMA, EggNOG
Opossum	100023618	RAB20	RAB20, member RAS oncogene family	13616		Inparanoid, OMA, EggNOG
Platypus		RAB20	RAB20, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:18260]	9258		OMA, EggNOG
Chicken	418753	RAB20	RAB20, member RAS oncogene family	9031	CGNC:12639	Inparanoid, OMA, EggNOG
Anole lizard	100552246	rab20	RAB20, member RAS oncogene family	28377		Inparanoid, OMA, EggNOG
Xenopus	550049	rab20	RAB20, member RAS oncogene family	8364	XB-GENE-494912	Inparanoid, OMA, EggNOG
Zebrafish	337199	rab20	RAB20, member RAS oncogene family	7955	ZDB-GENE-030131-9143	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.