JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

ECM1

Description	Extracellular matrix protein 1

Gene and Protein Information

Gene ID	1893
Uniprot Accession IDs	Q16610 A8K8S0 B4DW49 B4DY60 O43266 Q5T5G4 Q5T5G5 Q5T5G6 Q8IZ60
Ensembl ID	ENSG00000143369
Symbol	URBWD
Chromosome	1
Sequence	MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	746939	ECM1	extracellular matrix protein 1	9598	VGNC:1232	OMA, EggNOG
Macaque	707209	ECM1	extracellular matrix protein 1	9544		Inparanoid, OMA, EggNOG
Mouse	13601	Ecm1	extracellular matrix protein 1	10090	MGI:103060	Inparanoid, OMA, EggNOG
Rat	116662	Ecm1	extracellular matrix protein 1	10116	RGD:620357	Inparanoid, OMA, EggNOG
Horse	100054714	ECM1	extracellular matrix protein 1	9796	VGNC:17409	Inparanoid, OMA, EggNOG
Cow	524222	ECM1	extracellular matrix protein 1	9913	VGNC:28311	Inparanoid, OMA, EggNOG
Pig	100620701	ECM1	extracellular matrix protein 1	9823		Inparanoid, OMA, EggNOG
Opossum		ECM1	extracellular matrix protein 1 [Source:HGNC Symbol;Acc:HGNC:3153]	13616		Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.