JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

DCTPP1

Description	dCTP pyrophosphatase 1

Gene and Protein Information

Gene ID	79077
Uniprot Accession IDs	Q9H773
Ensembl ID	ENSG00000179958
Symbol	XTP3TPA CDA03 RS21C6 XTP3TPA
Chromosome	16
Sequence	MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	467948	DCTPP1	dCTP pyrophosphatase 1	9598	VGNC:13692	OMA, EggNOG
Macaque	710500	DCTPP1	dCTP pyrophosphatase 1	9544		Inparanoid, EggNOG
Mouse	66422	Dctpp1	dCTP pyrophosphatase 1	10090	MGI:1913672	Inparanoid, OMA, EggNOG
Rat	192252	Dctpp1	dCTP pyrophosphatase 1	10116	RGD:620933	Inparanoid, OMA, EggNOG
Dog	489903	DCTPP1	dCTP pyrophosphatase 1	9615		Inparanoid, OMA, EggNOG
Horse	100065556	DCTPP1	dCTP pyrophosphatase 1	9796	VGNC:17061	Inparanoid, OMA, EggNOG
Cow	614103	DCTPP1	dCTP pyrophosphatase 1	9913	VGNC:27934	Inparanoid, OMA, EggNOG
Opossum	100017749	DCTPP1	dCTP pyrophosphatase 1	13616		Inparanoid, OMA, EggNOG
Anole lizard	100558769	dctpp1	dCTP pyrophosphatase 1	28377		Inparanoid, OMA, EggNOG
Xenopus	493314	dctpp1	dCTP pyrophosphatase 1	8364	XB-GENE-958670	Inparanoid, OMA, EggNOG
Zebrafish	393744	dctpp1	dCTP pyrophosphatase 1	7955	ZDB-GENE-040426-1741	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.