JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

DCBLD2

Description	Discoidin, CUB and LCCL domain-containing protein 2

Gene and Protein Information

Gene ID	131566
Uniprot Accession IDs	Q96PD2 B7WNL1 D3DN41 Q8N6M4 Q8TDX2
Ensembl ID	ENSG00000057019
Symbol	CLCP1 ESDN ESDN CLCP1
Chromosome	3
Sequence	MASRAVVRARRCPQCPQVRAAAAAPAWAALPLSRSLPPCSNSSSFSMPLFLLLLLVLLLLLEDAGAQQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVALAAVLVPVLVMVLTTLILILVCAWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDVFKEIL Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	460548	DCBLD2	discoidin, CUB and LCCL domain containing 2	9598	VGNC:7055	OMA, EggNOG
Macaque	700151	DCBLD2	discoidin, CUB and LCCL domain containing 2	9544		Inparanoid, OMA, EggNOG
Mouse	73379	Dcbld2	discoidin, CUB and LCCL domain containing 2	10090	MGI:1920629	Inparanoid, OMA, EggNOG
Rat	155696	Dcbld2	discoidin, CUB and LCCL domain containing 2	10116	RGD:620543	Inparanoid, OMA
Dog	487949	DCBLD2	discoidin, CUB and LCCL domain containing 2	9615	VGNC:39798	Inparanoid, OMA, EggNOG
Horse	100072384	DCBLD2	discoidin, CUB and LCCL domain containing 2	9796	VGNC:17035	Inparanoid, OMA, EggNOG
Cow	524608	DCBLD2	discoidin, CUB and LCCL domain containing 2	9913	VGNC:27909	Inparanoid, OMA, EggNOG
Opossum	100017786	DCBLD2	discoidin, CUB and LCCL domain containing 2	13616		Inparanoid, OMA, EggNOG
Platypus		DCBLD2	discoidin, CUB and LCCL domain containing 2 [Source:HGNC Symbol;Acc:HGNC:24627]	9258		OMA, EggNOG
Chicken	418379	DCBLD2	discoidin, CUB and LCCL domain containing 2	9031	CGNC:50750	Inparanoid, OMA
Anole lizard	100564847	dcbld2	discoidin, CUB and LCCL domain containing 2	28377		Inparanoid, OMA
Zebrafish	557649	dcbld2	discoidin, CUB and LCCL domain containing 2	7955	ZDB-GENE-070112-1822	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.