JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CD83

Description	CD83 antigen

Gene and Protein Information

Gene ID	9308
Uniprot Accession IDs	Q01151 Q5THX9 hCD83
Ensembl ID	ENSG00000112149
Symbol	BL11 HB15
Chromosome	6
Sequence	MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	462446	CD83	CD83 molecule	9598	VGNC:11041	OMA, EggNOG
Macaque	701825	CD83	CD83 molecule	9544		Inparanoid, OMA, EggNOG
Mouse	12522	Cd83	CD83 antigen	10090	MGI:1328316	Inparanoid, OMA, EggNOG
Rat	361226	Cd83	CD83 molecule	10116	RGD:1309677	Inparanoid, OMA, EggNOG
Dog	610141	CD83	CD83 molecule	9615	VGNC:38977	Inparanoid, OMA, EggNOG
Horse		CD83	CD83 molecule [Source:HGNC Symbol;Acc:HGNC:1703]	9796		OMA, EggNOG
Cow	617034	CD83	CD83 molecule	9913	VGNC:27050	Inparanoid, OMA, EggNOG
Pig	100153365	CD83	CD83 molecule	9823		OMA, EggNOG
Opossum	100026047	CD83	CD83 molecule	13616		Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.