JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Account

Settings

Language

྾

Home
Targets(Human)
CEBPA

CEBPA

Description	CCAAT/enhancer-binding protein alpha

Gene and Protein Information

Gene ID	1050
Uniprot Accession IDs	P49715 A7LNP2 P78319 Q05CA4 C/EBP alpha
Ensembl ID	ENSG00000245848
Symbol	CEBP CEBP C/EBP-alpha
Chromosome	19
Family	Belongs to the bZIP family. C/EBP subfamily.
Sequence	MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	12606	Cebpa	CCAAT/enhancer binding protein (C/EBP), alpha	10090	MGI:99480	Inparanoid, OMA, EggNOG
Rat	24252	Cebpa	CCAAT/enhancer binding protein alpha	10116	RGD:2326	Inparanoid, OMA, EggNOG
Pig	397307	CEBPA	CCAAT/enhancer binding protein alpha	9823		Inparanoid, OMA, EggNOG
Platypus		CEBPA	CCAAT/enhancer binding protein alpha [Source:HGNC Symbol;Acc:HGNC:1833]	9258		OMA, EggNOG
Xenopus	496454	cebpa	CCAAT enhancer binding protein alpha	8364	XB-GENE-853397	Inparanoid, OMA
Zebrafish	140815	cebpa	CCAAT enhancer binding protein alpha	7955	ZDB-GENE-020111-2	Inparanoid, OMA

Protein Classes

PANTHER Classes
protein / transcription factor / basic leucine zipper transcription factor / CCAAT/enhancer-binding protein alpha
protein / transcription factor / nucleic acid binding / CCAAT/enhancer-binding protein alpha

DTO Classes
protein / Transcription factor / Basic leucine zipper transcription factor / CCAAT/enhancer-binding protein alpha

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Related active small molecules

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.