This is a demo store. No orders will be fulfilled.

CD81

Description CD81 antigen

Gene and Protein Information

Gene ID 975
Uniprot Accession IDs P60033 P18582 Q5U0J6
Ensembl ID ENSG00000110651
Symbol TAPA1 TSPAN28 S5.7 CVID6 TAPA1 TSPAN28
Chromosome 11
Family Belongs to the tetraspanin (TM4SF) family.
Sequence
MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 449635 CD81 CD81 molecule 9598 VGNC:11288 Inparanoid, OMA, EggNOG
Macaque 704961 CD81 CD81 molecule 9544 Inparanoid, OMA, EggNOG
Mouse 12520 Cd81 CD81 antigen 10090 MGI:1096398 Inparanoid, OMA, EggNOG
Rat 25621 Cd81 Cd81 molecule 10116 RGD:2315 Inparanoid, OMA, EggNOG
Dog 611606 CD81 CD81 molecule 9615 VGNC:49705 Inparanoid, OMA, EggNOG
Horse CD81 CD81 molecule [Source:HGNC Symbol;Acc:HGNC:1701] 9796 OMA, EggNOG
Cow 511435 CD81 CD81 molecule 9913 VGNC:50034 Inparanoid, OMA, EggNOG
Chicken 374256 CD81 CD81 molecule 9031 CGNC:4936 Inparanoid, OMA
Anole lizard 100565415 cd81 CD81 molecule 28377 OMA, EggNOG
Xenopus 394885 cd81 CD81 protein 8364 XB-GENE-946220 Inparanoid, OMA, EggNOG
Zebrafish 58031 cd81a CD81 molecule a 7955 ZDB-GENE-000831-5 OMA, EggNOG
C. elegans 192059 tsp-3 TetraSPanin family 6239 OMA, EggNOG

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.