JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Account

Settings

Language

྾

Home
Targets(Human)
CEBPE

CEBPE

Description	CCAAT/enhancer-binding protein epsilon

Gene and Protein Information

Gene ID	1053
Uniprot Accession IDs	Q15744 Q15745 Q8IYI2 Q99803 C/EBP epsilon
Ensembl ID	ENSG00000092067
Symbol	CRP1 C/EBP-epsilon
Chromosome	14
Family	Belongs to the bZIP family. C/EBP subfamily.
Sequence	MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	743538	CEBPE	CCAAT enhancer binding protein epsilon	9598	VGNC:8195	OMA, EggNOG
Macaque	713442	CEBPE	CCAAT/enhancer binding protein epsilon	9544		Inparanoid, OMA, EggNOG
Mouse	110794	Cebpe	CCAAT/enhancer binding protein (C/EBP), epsilon	10090	MGI:103572	Inparanoid, OMA
Rat	25410	Cebpe	CCAAT/enhancer binding protein epsilon	10116	RGD:2329	Inparanoid, OMA
Horse	100052512	CEBPE	CCAAT enhancer binding protein epsilon	9796	VGNC:16381	Inparanoid, OMA
Cow	534346	CEBPE	CCAAT enhancer binding protein epsilon	9913	VGNC:27162	Inparanoid, OMA
Anole lizard	100554198	cebpe	CCAAT/enhancer binding protein epsilon	28377		Inparanoid, OMA
Xenopus		CEBPE	CCAAT/enhancer binding protein epsilon [Source:HGNC Symbol;Acc:HGNC:1836]	8364		OMA, EggNOG

Protein Classes

PANTHER Classes
protein / transcription factor / basic leucine zipper transcription factor / CCAAT/enhancer-binding protein epsilon
protein / transcription factor / nucleic acid binding / CCAAT/enhancer-binding protein epsilon

DTO Classes
protein / Transcription factor / Basic leucine zipper transcription factor / CCAAT/enhancer-binding protein epsilon

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Related active small molecules

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.