JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CD3D

Description	T-cell surface glycoprotein CD3 delta chain

Gene and Protein Information

Gene ID	915
Uniprot Accession IDs	P04234 A8MVP6
Ensembl ID	ENSG00000167286
Symbol	T3D T3D IMD19 CD3-DELTA
Chromosome	11
Sequence	MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	451584	CD3D	CD3d molecule	9598	VGNC:6481	OMA, EggNOG
Macaque	699582	CD3D	CD3d molecule	9544		Inparanoid, EggNOG
Mouse	12500	Cd3d	CD3 antigen, delta polypeptide	10090	MGI:88331	Inparanoid, OMA, EggNOG
Rat	25710	Cd3d	CD3d molecule	10116	RGD:2304	Inparanoid, OMA, EggNOG
Dog	479419	CD3D	CD3d molecule	9615	VGNC:38954	Inparanoid, OMA, EggNOG
Horse	100062931	CD3D	CD3d molecule	9796	VGNC:16263	Inparanoid, OMA, EggNOG
Cow	281053	CD3D	CD3d molecule	9913	VGNC:27028	Inparanoid, OMA, EggNOG
Pig	396661	CD3D	CD3d molecule	9823		Inparanoid, OMA, EggNOG
Opossum	100031472	CD3D	CD3d molecule	13616		Inparanoid, OMA, EggNOG
Chicken	396518	CD3D	CD3d molecule	9031	CGNC:49849	OMA, EggNOG
Xenopus	100216101	cd3g	CD3g molecule	8364	XB-GENE-480422	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.