JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CD24

Description	Signal transducer CD24

Gene and Protein Information

Gene ID	100133941
Uniprot Accession IDs	P25063 A0A087WYI6 B6EC88 Q16257 Q53XS0 R4I4T5
Ensembl ID	ENSG00000272398
Symbol	CD24A CD24A
Chromosome	6
Family	Belongs to the CD24 family.
Sequence	MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	12484	Cd24a	CD24a antigen	10090	MGI:88323	Inparanoid, OMA
Rat	25145	Cd24	CD24 molecule	10116	RGD:2298	Inparanoid, OMA
Pig	100519934	LOC100519934	uncharacterized LOC100519934	9823		Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.