JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Account

Settings

Language

྾

Home
Targets(Human)
CD79A

CD79A

Description	B-cell antigen receptor complex-associated protein alpha chain

Gene and Protein Information

Gene ID	973
Uniprot Accession IDs	P11912 A0N775 Q53FB8
Ensembl ID	ENSG00000105369
Symbol	IGA MB1 IGA MB-1
Chromosome	19
Sequence	MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	740560	CD79A	CD79a molecule	9598	VGNC:3643	OMA, EggNOG
Mouse	12518	Cd79a	CD79A antigen (immunoglobulin-associated alpha)	10090	MGI:101774	Inparanoid, OMA, EggNOG
Rat	100913063	Cd79a	CD79a molecule	10116	RGD:6484896	OMA, EggNOG
Dog	484483	CD79A	CD79a molecule	9615	VGNC:38973	Inparanoid, OMA, EggNOG
Horse	100052219	CD79A	CD79a molecule	9796	VGNC:16279	Inparanoid, OMA, EggNOG
Cow	281674	CD79A	CD79a molecule	9913	VGNC:27046	Inparanoid, OMA, EggNOG
Anole lizard	103282538	cd79a	CD79a molecule	28377		Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    immunoglobulin receptor superfamily    /    B-cell antigen receptor complex-associated protein alpha chain
protein    /    receptor    /    defense/immunity protein    /    B-cell antigen receptor complex-associated protein alpha chain
protein    /    receptor    /    cytokine receptor    /    B-cell antigen receptor complex-associated protein alpha chain

DTO Classes
protein / Receptor / Cytokine receptor / Immunoglobulin receptor superfamily / B-cell antigen receptor complex-associated protein alpha chain

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Related active small molecules

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.