JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

DYNLRB1

Description	Dynein light chain roadblock-type 1

Gene and Protein Information

Gene ID	83658
Uniprot Accession IDs	Q9NP97 B1AKR5 Q5TC72 Q96IV3 Q9NQM2
Ensembl ID	ENSG00000125971
Symbol	BITH DNCL2A DNLC2A ROBLD1 BLP BITH DNCL2A DNLC2A ROBLD1
Chromosome	20
Family	Belongs to the GAMAD family.
Sequence	MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	458192	DYNLRB1	dynein light chain roadblock-type 1	9598	VGNC:14128	OMA, EggNOG
Macaque	100428465	DYNLRB1	dynein light chain roadblock-type 1	9544		OMA, EggNOG
Mouse	67068	Dynlrb1	dynein light chain roadblock-type 1	10090	MGI:1914318	Inparanoid, OMA, EggNOG
Rat	170714	Dynlrb1	dynein light chain roadblock-type 1	10116	RGD:619910	Inparanoid, OMA, EggNOG
Dog	477200	DYNLRB1	dynein light chain roadblock-type 1	9615	VGNC:40152	Inparanoid, OMA, EggNOG
Horse	100069352	DYNLRB1	dynein light chain roadblock-type 1	9796	VGNC:51533	OMA, EggNOG
Cow	513342	DYNLRB1	dynein light chain roadblock-type 1	9913	VGNC:28276	Inparanoid, OMA, EggNOG
Opossum	100032367	DYNLRB1	dynein light chain roadblock-type 1	13616		Inparanoid, EggNOG
Anole lizard	100567198	dynlrb1	dynein light chain roadblock-type 1	28377		Inparanoid, OMA
Xenopus	100101695	dynlrb1	dynein light chain roadblock-type 1	8364	XB-GENE-489076	Inparanoid, OMA
Zebrafish	394163	dynlrb1	dynein, light chain, roadblock-type 1	7955	ZDB-GENE-040426-989	Inparanoid, OMA

PANTHER Classes
protein / cytoskeletal protein / microtubule family cytoskeletal protein / Dynein light chain roadblock-type 1

DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Dynein light chain roadblock-type 1

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.