JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

PDF

Description	Peptide deformylase, mitochondrial

Gene and Protein Information

Gene ID	64146
Uniprot Accession IDs	Q9HBH1 Q8WUN6
Ensembl ID	ENSG00000258429
Symbol	PDF1A
Chromosome	16
Family	Belongs to the polypeptide deformylase family.
Sequence	MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Rat	690214	Pdf	peptide deformylase (mitochondrial)	10116	RGD:1582894	Inparanoid, OMA, EggNOG
Dog	610955	PDF	peptide deformylase, mitochondrial	9615	VGNC:49608	Inparanoid, OMA, EggNOG
Cow	788473	PDF	peptide deformylase, mitochondrial	9913	VGNC:49562	Inparanoid, OMA, EggNOG
Opossum	100027986	PDF	peptide deformylase, mitochondrial	13616		Inparanoid, EggNOG
Anole lizard	100560353	pdf	peptide deformylase, mitochondrial	28377		Inparanoid, OMA, EggNOG
Xenopus	448425	pdf	peptide deformylase, mitochondrial	8364	XB-GENE-1010345	Inparanoid, OMA, EggNOG
Zebrafish	619248	pdf	peptide deformylase, mitochondrial	7955	ZDB-GENE-050913-42	Inparanoid, OMA, EggNOG
Fruitfly	318700	CG31373	CG31373 gene product from transcript CG31373-RA	7227	FBgn0051373	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.