The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
PDF
| Description |
Peptide deformylase, mitochondrial
|
Gene and Protein Information
| Gene ID |
64146
|
| Uniprot Accession IDs |
Q9HBH1
Q8WUN6
|
| Ensembl ID |
ENSG00000258429
|
| Symbol |
PDF1A
|
| Chromosome |
16
|
| Family |
Belongs to the polypeptide deformylase family. |
| Sequence |
MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Rat |
690214 |
Pdf |
peptide deformylase (mitochondrial) |
10116 |
RGD:1582894 |
Inparanoid, OMA, EggNOG |
| Dog |
610955 |
PDF |
peptide deformylase, mitochondrial |
9615 |
VGNC:49608 |
Inparanoid, OMA, EggNOG |
| Cow |
788473 |
PDF |
peptide deformylase, mitochondrial |
9913 |
VGNC:49562 |
Inparanoid, OMA, EggNOG |
| Opossum |
100027986 |
PDF |
peptide deformylase, mitochondrial |
13616 |
|
Inparanoid, EggNOG |
| Anole lizard |
100560353 |
pdf |
peptide deformylase, mitochondrial |
28377 |
|
Inparanoid, OMA, EggNOG |
| Xenopus |
448425 |
pdf |
peptide deformylase, mitochondrial |
8364 |
XB-GENE-1010345 |
Inparanoid, OMA, EggNOG |
| Zebrafish |
619248 |
pdf |
peptide deformylase, mitochondrial |
7955 |
ZDB-GENE-050913-42 |
Inparanoid, OMA, EggNOG |
| Fruitfly |
318700 |
CG31373 |
CG31373 gene product from transcript CG31373-RA |
7227 |
FBgn0051373 |
Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.