JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

GJB7

Description	Gap junction beta-7 protein

Gene and Protein Information

Gene ID	375519
Uniprot Accession IDs	Q6PEY0 B3KXL0 Q96KP0
Ensembl ID	ENSG00000164411
Symbol	CX25 CX25 bA136M9.1 connexin25
Chromosome	6
Family	Belongs to the connexin family. Beta-type (group I) subfamily.
Sequence	MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSV

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Horse	100070584	GJB7	gap junction protein beta 7	9796	VGNC:51032	Inparanoid, OMA
Opossum	100025224	GJB7	gap junction protein beta 7	13616		Inparanoid, OMA
Xenopus	100488401	gjb7	gap junction protein beta 7	8364	XB-GENE-965093	Inparanoid, OMA
Zebrafish	566668	cx28.8	connexin 28.8	7955	ZDB-GENE-050616-1	Inparanoid, OMA

PANTHER Classes
protein / cell junction protein / gap junction / Gap junction beta-7 protein

DTO Classes
protein / Cell-cell junction / Gap junction / Gap junction beta-7 protein

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.