This is a demo store. No orders will be fulfilled.
| Description | Density-regulated protein |
|---|
Gene and Protein Information
| Gene ID | 8562 |
|---|---|
| Uniprot Accession IDs | O43583 Q9H3U6 Q9UKZ0 DRP |
| Ensembl ID | ENSG00000139726 |
| Symbol | DRP1 DRP DRP1 SMAP-3 |
| Chromosome | 12 |
| Family | Belongs to the DENR family. |
| Sequence |
MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 68184 | Denr | density-regulated protein | 10090 | MGI:1915434 | Inparanoid, OMA, EggNOG |
| Rat | 687565 | Denr | density regulated reinitiation and release factor | 10116 | RGD:1584200 | Inparanoid, OMA |
| Dog | 610709 | DENR | density regulated re-initiation and release factor | 9615 | VGNC:52927 | Inparanoid, OMA, EggNOG |
| Horse | 100060440 | DENR | density regulated re-initiation and release factor | 9796 | VGNC:17131 | Inparanoid, OMA, EggNOG |
| Cow | 614238 | DENR | density-regulated protein | 9913 | OMA, EggNOG | |
| Pig | 100156971 | DENR | density regulated re-initiation and release factor | 9823 | OMA, EggNOG | |
| Opossum | 100016704 | DENR | density regulated re-initiation and release factor | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100075470 | DENR | density regulated re-initiation and release factor | 9258 | OMA, EggNOG | |
| Chicken | 771794 | DENR | density regulated re-initiation and release factor | 9031 | CGNC:2776 | Inparanoid, OMA |
| Anole lizard | 100554171 | denr | density regulated re-initiation and release factor | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448530 | denr | density-regulated protein | 8364 | XB-GENE-1002798 | Inparanoid, OMA, EggNOG |
| Zebrafish | 436970 | denr | density-regulated protein | 7955 | ZDB-GENE-040718-450 | Inparanoid, OMA, EggNOG |
| C. elegans | 176556 | Y47D3A.21 | Density-regulated protein homolog | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 32679 | DENR | Density regulated protein | 7227 | FBgn0030802 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 853471 | TMA22 | Tma22p | 4932 | S000003775 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / translation initiation factor / Density-regulated protein
protein / nucleic acid binding / nuclease / Density-regulated protein
protein / nucleic acid binding / translation initiation factor / Density-regulated protein
protein / nucleic acid binding / nuclease / Density-regulated protein
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later