The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
DIABLO
| Description |
Diablo homolog, mitochondrial
|
Gene and Protein Information
| Gene ID |
56616
|
| Uniprot Accession IDs |
Q9NR28
B2RDQ0
Q6W3F3
Q96LV0
Q9BT11
Q9HAV6
|
| Ensembl ID |
ENSG00000184047
|
| Symbol |
SMAC
SMAC
DFNA64
|
| Chromosome |
12
|
| Sequence |
MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Mouse |
66593 |
Diablo |
diablo, IAP-binding mitochondrial protein |
10090 |
MGI:1913843 |
Inparanoid, OMA |
| Rat |
100360940 |
LOC100360940 |
diablo-like |
10116 |
RGD:2321120 |
Inparanoid, OMA |
| Dog |
477463 |
DIABLO |
diablo IAP-binding mitochondrial protein |
9615 |
VGNC:39954 |
Inparanoid, OMA |
| Horse |
100058709 |
DIABLO |
diablo IAP-binding mitochondrial protein |
9796 |
VGNC:17182 |
Inparanoid, OMA |
| Cow |
493999 |
DIABLO |
diablo IAP-binding mitochondrial protein |
9913 |
VGNC:28061 |
Inparanoid, OMA |
| Pig |
100155744 |
DIABLO |
diablo IAP-binding mitochondrial protein |
9823 |
|
Inparanoid, OMA |
| Opossum |
100022080 |
DIABLO |
diablo IAP-binding mitochondrial protein |
13616 |
|
Inparanoid, OMA |
| Chicken |
416860 |
DIABLO |
diablo IAP-binding mitochondrial protein |
9031 |
CGNC:3247 |
Inparanoid, OMA |
| Anole lizard |
100566579 |
diablo |
diablo IAP-binding mitochondrial protein |
28377 |
|
Inparanoid, OMA |
| Xenopus |
549035 |
diablo |
diablo, IAP-binding mitochondrial protein |
8364 |
XB-GENE-5915561 |
Inparanoid, OMA |
| Zebrafish |
570425 |
diablob |
diablo, IAP-binding mitochondrial protein b |
7955 |
ZDB-GENE-070112-202 |
Inparanoid, OMA |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.