JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

DIABLO

Description	Diablo homolog, mitochondrial

Gene and Protein Information

Gene ID	56616
Uniprot Accession IDs	Q9NR28 B2RDQ0 Q6W3F3 Q96LV0 Q9BT11 Q9HAV6
Ensembl ID	ENSG00000184047
Symbol	SMAC SMAC DFNA64
Chromosome	12
Sequence	MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	66593	Diablo	diablo, IAP-binding mitochondrial protein	10090	MGI:1913843	Inparanoid, OMA
Rat	100360940	LOC100360940	diablo-like	10116	RGD:2321120	Inparanoid, OMA
Dog	477463	DIABLO	diablo IAP-binding mitochondrial protein	9615	VGNC:39954	Inparanoid, OMA
Horse	100058709	DIABLO	diablo IAP-binding mitochondrial protein	9796	VGNC:17182	Inparanoid, OMA
Cow	493999	DIABLO	diablo IAP-binding mitochondrial protein	9913	VGNC:28061	Inparanoid, OMA
Pig	100155744	DIABLO	diablo IAP-binding mitochondrial protein	9823		Inparanoid, OMA
Opossum	100022080	DIABLO	diablo IAP-binding mitochondrial protein	13616		Inparanoid, OMA
Chicken	416860	DIABLO	diablo IAP-binding mitochondrial protein	9031	CGNC:3247	Inparanoid, OMA
Anole lizard	100566579	diablo	diablo IAP-binding mitochondrial protein	28377		Inparanoid, OMA
Xenopus	549035	diablo	diablo, IAP-binding mitochondrial protein	8364	XB-GENE-5915561	Inparanoid, OMA
Zebrafish	570425	diablob	diablo, IAP-binding mitochondrial protein b	7955	ZDB-GENE-070112-202	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.