JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CCND3

Description	G1/S-specific cyclin-D3

Gene and Protein Information

Gene ID	896
Uniprot Accession IDs	P30281 B2RD63 B3KQ22 E9PAS4 E9PB36 Q5T8J0 Q6FG62 Q96F49
Ensembl ID	ENSG00000112576
Chromosome	6
Family	Belongs to the cyclin family. Cyclin D subfamily.
Sequence	MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	462689	CCND3	cyclin D3	9598	VGNC:11040	OMA, EggNOG
Macaque	695215	CCND3	cyclin D3	9544		Inparanoid, OMA, EggNOG
Mouse	12445	Ccnd3	cyclin D3	10090	MGI:88315	Inparanoid, OMA, EggNOG
Rat	25193	Ccnd3	cyclin D3	10116	RGD:2293	Inparanoid, OMA, EggNOG
Dog	608847	CCND3	cyclin D3	9615	VGNC:54284	Inparanoid, OMA
Horse	100066590	CCND3	cyclin D3	9796	VGNC:16209	Inparanoid, OMA
Cow	540547	CCND3	cyclin D3	9913	VGNC:26964	Inparanoid, OMA
Opossum	100027538	CCND3	cyclin D3	13616		Inparanoid, OMA
Chicken	419928	CCND3	cyclin D3	9031	CGNC:2542	Inparanoid, OMA
Anole lizard	100566165	ccnd3	cyclin D3	28377		Inparanoid, OMA
C. elegans	174941	cyd-1	G1/S-specific cyclin-D	6239		Inparanoid, OMA

PANTHER Classes
protein / enzyme modulator / kinase activator / G1/S-specific cyclin-D3

DTO Classes
protein / Enzyme modulator / Kinase modulator / Kinase activator / G1/S-specific cyclin-D3

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.