JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CCL20

Description	C-C motif chemokine 20

Gene and Protein Information

Gene ID	6364
Uniprot Accession IDs	P78556 Q53S51 Q99664
Ensembl ID	ENSG00000115009
Symbol	LARC MIP3A SCYA20 CKb4 LARC ST38 MIP3A Exodus MIP-3a SCYA20 MIP-3-alpha
Chromosome	2
Family	Belongs to the intercrine beta (chemokine CC) family.
Sequence	MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	459991	CCL20	C-C motif chemokine ligand 20	9598	VGNC:125	OMA, EggNOG
Macaque	574182	CCL20	C-C motif chemokine ligand 20	9544		Inparanoid, OMA, EggNOG
Mouse	20297	Ccl20	chemokine (C-C motif) ligand 20	10090	MGI:1329031	Inparanoid, OMA, EggNOG
Rat	29538	Ccl20	C-C motif chemokine ligand 20	10116	RGD:3646	Inparanoid, OMA
Dog	448790	CCL20	C-C motif chemokine ligand 20	9615	VGNC:38884	Inparanoid, OMA, EggNOG
Horse	100629808	CCL20	C-C motif chemokine ligand 20	9796	VGNC:16198	Inparanoid, OMA, EggNOG
Cow	281666	CCL20	C-C motif chemokine ligand 20	9913	VGNC:26947	Inparanoid, OMA, EggNOG
Pig	553951	CCL20	C-C motif chemokine ligand 20	9823		Inparanoid, OMA, EggNOG
Opossum	100021210	CCL20	C-C motif chemokine ligand 20	13616		Inparanoid, OMA, EggNOG
Chicken	395082	CCL20	C-C motif chemokine ligand 20	9031	CGNC:2171	OMA, EggNOG

PANTHER Classes
protein / signaling molecule / chemokine / C-C motif chemokine 20

DTO Classes
protein / Signaling / Chemokine / C-C motif chemokine 20

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.