JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CCL26

Description	C-C motif chemokine 26

Gene and Protein Information

Gene ID	10344
Uniprot Accession IDs	Q9Y258 A0N0Q5 Q52LV8
Ensembl ID	ENSG00000006606
Symbol	SCYA26 IMAC TSC-1 MIP-4a SCYA26 MIP-4alpha
Chromosome	7
Family	Belongs to the intercrine beta (chemokine CC) family.
Sequence	MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	472417	CCL26	C-C motif chemokine ligand 26	9598	VGNC:4302	OMA, EggNOG
Macaque	716099	CCL26	C-C motif chemokine ligand 26	9544		Inparanoid, OMA, EggNOG
Mouse	541307	Ccl26	chemokine (C-C motif) ligand 26	10090	MGI:3589281	Inparanoid, OMA, EggNOG
Rat	685958	Ccl26	C-C motif chemokine ligand 26	10116	RGD:1587817	Inparanoid, OMA, EggNOG
Dog	448789	CCL26	C-C motif chemokine ligand 26	9615	VGNC:38888	Inparanoid, OMA, EggNOG
Horse	100630602	CCL26	C-C motif chemokine ligand 26	9796	VGNC:51119	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / signaling molecule / chemokine / C-C motif chemokine 26

DTO Classes
protein / Signaling / Chemokine / C-C motif chemokine 26

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.