JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CBR1

Description	Carbonyl reductase [NADPH] 1

Gene and Protein Information

Gene ID	873
Uniprot Accession IDs	P16152 B2RBZ7 B4DFK7 Q3LHW8
Ensembl ID	ENSG00000159228
Symbol	CBR CRN SDR21C1 CBR hCBR1 SDR21C1
Chromosome	21
Family	Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Sequence	MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	473983	CBR1	carbonyl reductase 1	9598	VGNC:14651	OMA, EggNOG
Macaque	699655	LOC699655	carbonyl reductase [NADPH] 1	9544		OMA, EggNOG
Mouse	12408	Cbr1	carbonyl reductase 1	10090	MGI:88284	Inparanoid, OMA, EggNOG
Rat	102556347	LOC102556347	carbonyl reductase [NADPH] 1-like	10116	RGD:7631561	OMA, EggNOG
Dog	610164	LOC610164	carbonyl reductase [NADPH] 1	9615		OMA, EggNOG
Horse	100061787	LOC100061787	carbonyl reductase [NADPH] 1	9796		Inparanoid, OMA, EggNOG
Cow	515946	CBR1	carbonyl reductase 1	9913		OMA, EggNOG
Pig		-	carbonyl reductase [Source:RefSeq peptide;Acc:NP_001302675]	9823		OMA, EggNOG
Platypus	100081857	LOC100081857	carbonyl reductase [NADPH] 1	9258		OMA, EggNOG
Chicken	418512	CBR1	carbonyl reductase 1	9031	CGNC:50782	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.