JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CCL21

Description	C-C motif chemokine 21

Gene and Protein Information

Gene ID	6366
Uniprot Accession IDs	O00585 Q6ICR7
Ensembl ID	ENSG00000137077
Symbol	SCYA21 ECL SLC CKb9 TCA4 6Ckine SCYA21
Chromosome	9
Family	Belongs to the intercrine beta (chemokine CC) family.
Sequence	MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	746205	CCL21	C-C motif chemokine ligand 21	9598	VGNC:4651	OMA, EggNOG
Mouse	18829	Ccl21a	chemokine (C-C motif) ligand 21A (serine)	10090	MGI:1349183	Inparanoid, OMA
Mouse	100862177	Gm21541	predicted gene, 21541	10090	MGI:5434896	OMA, EggNOG
Rat	298006	Ccl21	C-C motif chemokine ligand 21	10116	RGD:1311996	Inparanoid, OMA, EggNOG
Horse	100063059	CCL21	C-C motif chemokine ligand 21	9796		OMA, EggNOG
Horse	100060619	LOC100060619	C-C motif chemokine 21-like	9796		Inparanoid, OMA
Cow	511112	CCL21	C-C motif chemokine ligand 21	9913	VGNC:26948	Inparanoid, OMA, EggNOG
Opossum	100028728	CCL21	C-C motif chemokine ligand 21	13616		Inparanoid, OMA, EggNOG

PANTHER Classes
protein / signaling molecule / chemokine / C-C motif chemokine 21

DTO Classes
protein / Signaling / Chemokine / C-C motif chemokine 21

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.