JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

COX5B

Description	Cytochrome c oxidase subunit 5B, mitochondrial

Gene and Protein Information

Gene ID	1329
Uniprot Accession IDs	P10606 Q53YB7 Q96J18 Q99610
Ensembl ID	ENSG00000135940
Symbol	COXVB
Chromosome	2
Family	Belongs to the cytochrome c oxidase subunit 5B family.
Sequence	MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	741789	COX5B	cytochrome c oxidase subunit 5B	9598	VGNC:10525	OMA, EggNOG
Mouse	12859	Cox5b	cytochrome c oxidase subunit Vb	10090	MGI:88475	Inparanoid, OMA
Mouse	100040340	Gm11273	predicted gene 11273	10090	MGI:3649411	OMA, EggNOG
Rat	94194	Cox5b	cytochrome c oxidase subunit 5B	10116	RGD:620608	Inparanoid, OMA, EggNOG
Dog	474567	COX5B	cytochrome c oxidase subunit 5B	9615	VGNC:39540	Inparanoid, OMA, EggNOG
Horse	100061973	COX5B	cytochrome c oxidase subunit 5B	9796	VGNC:16804	Inparanoid, OMA, EggNOG
Cow	287012	COX5B	cytochrome c oxidase subunit Vb	9913		Inparanoid, OMA, EggNOG
Pig	492822	COX5B	mitochondrial cytochrome c oxidase subunit Vb	9823		Inparanoid, OMA, EggNOG
Anole lizard	100563950	LOC100563950	cytochrome c oxidase subunit 5B, mitochondrial	28377		Inparanoid, OMA, EggNOG
Xenopus	549004	cox5b.1	cytochrome c oxidase subunit Vb, gene 1	8364	XB-GENE-964002	OMA, EggNOG
Zebrafish	415253	zgc:86599	zgc:86599	7955	ZDB-GENE-040625-180	Inparanoid, OMA, EggNOG
C. elegans	172832	cox-5B	Cytochrome OXidase assembly protein	6239		OMA, EggNOG

PANTHER Classes
protein / oxidoreductase / oxidase / Cytochrome c oxidase subunit 5B, mitochondrial

DTO Classes
protein / Enzyme / Oxidoreductase / Oxidase / Cytochrome c oxidase subunit 5B, mitochondrial

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.