JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Account

Settings

Language

྾

Home
Targets(Human)
MYL4

MYL4

Description	Myosin light chain 4

Gene and Protein Information

Gene ID	4635
Uniprot Accession IDs	P12829 D3DXJ7 P11783
Ensembl ID	ENSG00000198336
Symbol	MLC1 GT1 ALC1 AMLC PRO1957
Chromosome	17
Sequence	MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	454814	MYL4	myosin light chain 4	9598	VGNC:9450	OMA, EggNOG
Macaque	717354	MYL4	myosin light chain 4	9544		Inparanoid, OMA, EggNOG
Mouse	17896	Myl4	myosin, light polypeptide 4	10090	MGI:97267	Inparanoid, OMA, EggNOG
Rat	688228	Myl4	myosin, light chain 4	10116	RGD:1591197	Inparanoid, OMA, EggNOG
Dog		MYL4	myosin light chain 4 [Source:HGNC Symbol;Acc:HGNC:7585]	9615		OMA, EggNOG
Horse	100054510	MYL4	myosin light chain 4	9796	VGNC:20485	Inparanoid, OMA, EggNOG
Cow	504201	MYL4	myosin light chain 4	9913	VGNC:31802	Inparanoid, OMA, EggNOG
Pig	100516998	MYL4	myosin light chain 4	9823		Inparanoid, OMA, EggNOG
Opossum	100021133	MYL4	myosin light chain 4	13616		Inparanoid, OMA, EggNOG
Chicken	396472	MYL4	myosin, light chain 4, alkali; atrial, embryonic	9031	CGNC:49822	Inparanoid, OMA
Anole lizard	100558684	myl4	myosin light chain 4	28377		Inparanoid, OMA
Xenopus	100124786	myl4	myosin light chain 4	8364	XB-GENE-977611	Inparanoid, OMA

Protein Classes

PANTHER Classes
protein / calcium-binding protein / calmodulin / Myosin light chain 4
protein / calcium-binding protein / actin family cytoskeletal protein / Myosin light chain 4

DTO Classes
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Myosin light chain 4

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Related active small molecules

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.