JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

PDPN

Description	Podoplanin

Gene and Protein Information

Gene ID	10630
Uniprot Accession IDs	Q86YL7 A9Z1Y2 B2R6J8 E9PB68 F6QWX5 O60836 O95128 Q7L375 Q8NBQ8 Q8NBR3
Ensembl ID	ENSG00000162493
Symbol	GP36 T1A GP36 GP40 Gp38 OTS8 T1A2 TI1A T1A-2 AGGRUS HT1A-1 PA2.26
Chromosome	1
Family	Belongs to the podoplanin family.
Sequence	MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	716250	PDPN	podoplanin	9544		Inparanoid, OMA, EggNOG
Mouse	14726	Pdpn	podoplanin	10090	MGI:103098	Inparanoid, OMA, EggNOG
Rat	54320	Pdpn	podoplanin	10116	RGD:61819	Inparanoid, OMA, EggNOG
Dog	403886	PDPN	podoplanin	9615	VGNC:52226	Inparanoid, OMA, EggNOG
Cow	509732	PDPN	podoplanin	9913	VGNC:50142	OMA, EggNOG
Pig	100738269	PDPN	podoplanin	9823		OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.