JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

NCR3

Description	Natural cytotoxicity triggering receptor 3

Gene and Protein Information

Gene ID	259197
Uniprot Accession IDs	O14931 B0S8F2 B0S8F4 B0S8F5 O14930 O14932 O95667 O95668 O95669 Q5ST89 Q5ST90 Q5ST91 Q5ST92 Q5STA3
Ensembl ID	ENSG00000204475
Symbol	1C7 LY117 1C7 MALS CD337 LY117 NKp30
Chromosome	6
Family	Belongs to the natural cytotoxicity receptor (NCR) family.
Sequence	MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	449613	NCR3	natural cytotoxicity triggering receptor 3	9598	VGNC:11131	Inparanoid, OMA, EggNOG
Macaque	715574	NCR3	natural cytotoxicity triggering receptor 3	9544		Inparanoid, OMA
Rat	294251	Ncr3	natural cytotoxicity triggering receptor 3	10116	RGD:727881	Inparanoid, OMA, EggNOG
Dog	607220	NCR3	natural cytotoxicity triggering receptor 3	9615	VGNC:43666	Inparanoid, OMA, EggNOG
Horse	100058447	NCR3	natural cytotoxicity triggering receptor 3	9796	VGNC:20604	Inparanoid, OMA, EggNOG
Cow	513769	NCR3	natural cytotoxicity triggering receptor 3	9913	VGNC:31927	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.