JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

NGF

Description	Beta-nerve growth factor

Gene and Protein Information

Gene ID	4803
Uniprot Accession IDs	P01138 A1A4E5 Q6FHA0 Q96P60 Q9P2Q8 Q9UKL8 Beta-NGF
Ensembl ID	ENSG00000134259
Symbol	NGFB NGFB HSAN5 Beta-NGF
Chromosome	1
Family	Belongs to the NGF-beta family.
Sequence	MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	469423	NGF	nerve growth factor	9598	VGNC:8424	Inparanoid, OMA
Mouse	18049	Ngf	nerve growth factor	10090	MGI:97321	Inparanoid, OMA, EggNOG
Rat	310738	Ngf	nerve growth factor	10116	RGD:1598328	Inparanoid, OMA, EggNOG
Dog	403402	NGF	nerve growth factor	9615	VGNC:54333	Inparanoid, OMA, EggNOG
Horse	100065669	NGF	nerve growth factor	9796	VGNC:20727	Inparanoid, OMA, EggNOG
Cow	281350	NGF	nerve growth factor	9913	VGNC:32061	Inparanoid, OMA, EggNOG
Opossum		NGF	nerve growth factor [Source:HGNC Symbol;Acc:HGNC:7808]	13616		Inparanoid, OMA, EggNOG
Chicken	396466	NGF	nerve growth factor	9031	CGNC:1838	Inparanoid, OMA, EggNOG
Anole lizard	100553574	ngf	nerve growth factor	28377		OMA, EggNOG
Xenopus	100170161	ngf	nerve growth factor	8364	XB-GENE-1013200	Inparanoid, OMA, EggNOG
Zebrafish	58133	ngfb	nerve growth factor b (beta polypeptide)	7955	ZDB-GENE-000629-2	OMA, EggNOG
Zebrafish	30270	ngfa	nerve growth factor a (beta polypeptide)	7955	ZDB-GENE-990415-176	Inparanoid, OMA

PANTHER Classes
protein / growth factor / neurotrophic factor / Beta-nerve growth factor

DTO Classes
protein / Signaling / Growth factor / Neurotrophic factor / Beta-nerve growth factor

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.