This is a demo store. No orders will be fulfilled.
| Description | Melanin-concentrating hormone receptor 1 |
|---|
Gene and Protein Information
| Gene ID | 2847 |
|---|---|
| Uniprot Accession IDs | Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 MCH receptor 1 |
| Ensembl ID | ENSG00000128285 |
| Symbol | GPR24 SLC1 SLC1 GPR24 MCH1R SLC-1 MCH-1R |
| Chromosome | 22 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence |
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 470220 | MCHR1 | melanin concentrating hormone receptor 1 | 9598 | VGNC:5278 | Inparanoid, OMA, EggNOG |
| Macaque | 574232 | MCHR1 | melanin concentrating hormone receptor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 207911 | Mchr1 | melanin-concentrating hormone receptor 1 | 10090 | MGI:2180756 | Inparanoid, OMA, EggNOG |
| Rat | 83567 | Mchr1 | melanin-concentrating hormone receptor 1 | 10116 | RGD:619841 | Inparanoid, OMA, EggNOG |
| Dog | 403563 | MCHR1 | melanin concentrating hormone receptor 1 | 9615 | VGNC:43076 | Inparanoid, OMA, EggNOG |
| Horse | 100055460 | MCHR1 | melanin concentrating hormone receptor 1 | 9796 | VGNC:20030 | Inparanoid, OMA, EggNOG |
| Cow | 540119 | MCHR1 | melanin concentrating hormone receptor 1 | 9913 | VGNC:31305 | Inparanoid, OMA, EggNOG |
| Pig | 397295 | MCHR1 | melanin concentrating hormone receptor 1 | 9823 | OMA, EggNOG | |
| Opossum | 100027854 | MCHR1 | melanin concentrating hormone receptor 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100076680 | MCHR1 | melanin concentrating hormone receptor 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100564343 | LOC100564343 | melanin-concentrating hormone receptor 1 | 28377 | OMA, EggNOG | |
| Xenopus | 779692 | mchr1.2 | melanin-concentrating hormone receptor 1, gene 2 | 8364 | XB-GENE-1018376 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / Melanin-concentrating hormone receptor 1
protein / receptor / G-protein coupled receptor / Melanin-concentrating hormone receptor 1
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Melanin-concentrating hormone receptor / Melanin-concentrating hormone receptor 1
protein / G-protein coupled receptor / Class A rhodopsin like / Melanin-concentrating hormone receptor / Melanin-concentrating hormone receptor 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later