This is a demo store. No orders will be fulfilled.
| Description | Mitochondrial pyruvate carrier 1 |
|---|
Gene and Protein Information
| Gene ID | 51660 |
|---|---|
| Uniprot Accession IDs | Q9Y5U8 B2R5I7 Q5TI66 Q9HB67 Q9UQN4 |
| Ensembl ID | ENSG00000060762 |
| Symbol | BRP44L MPYCD BRP44L CGI-129 SLC54A1 |
| Chromosome | 6 |
| Family | Belongs to the mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family. |
| Sequence |
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 737234 | MPC1 | mitochondrial pyruvate carrier 1 | 9598 | VGNC:3488 | OMA, EggNOG |
| Macaque | 716864 | MPC1 | mitochondrial pyruvate carrier 1 | 9544 | OMA, EggNOG | |
| Mouse | 55951 | Mpc1 | mitochondrial pyruvate carrier 1 | 10090 | MGI:1915240 | Inparanoid, OMA, EggNOG |
| Rat | 171087 | Mpc1 | mitochondrial pyruvate carrier 1 | 10116 | RGD:620902 | Inparanoid, OMA, EggNOG |
| Horse | MPC1 | mitochondrial pyruvate carrier 1 [Source:HGNC Symbol;Acc:HGNC:21606] | 9796 | OMA, EggNOG | ||
| Cow | 767977 | MPC1 | mitochondrial pyruvate carrier 1 | 9913 | VGNC:31569 | Inparanoid, OMA, EggNOG |
| Opossum | MPC1 | mitochondrial pyruvate carrier 1 [Source:HGNC Symbol;Acc:HGNC:21606] | 13616 | Inparanoid, OMA, EggNOG | ||
| Platypus | 100074647 | MPC1 | mitochondrial pyruvate carrier 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 428592 | MPC1 | mitochondrial pyruvate carrier 1 | 9031 | CGNC:8725 | OMA, EggNOG |
| Anole lizard | 100553357 | mpc1 | mitochondrial pyruvate carrier 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448739 | mpc1 | mitochondrial pyruvate carrier 1 | 8364 | XB-GENE-970069 | OMA, EggNOG |
| Zebrafish | 436671 | mpc1 | mitochondrial pyruvate carrier 1 | 7955 | ZDB-GENE-040718-94 | Inparanoid, OMA, EggNOG |
| Fruitfly | 42268 | Mpc1 | Mitochondrial pyruvate carrier | 7227 | FBgn0038662 | Inparanoid, EggNOG |
| S.cerevisiae | 852800 | MPC1 | pyruvate transporter MPC1 | 4932 | S000003048 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC54 Mitochondrial pyruvate carriers / Mitochondrial pyruvate carrier 1
protein / Transporter / SLC superfamily of solute carriers / SLC54 Mitochondrial pyruvate carriers / Mitochondrial pyruvate carrier 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later