This is a demo store. No orders will be fulfilled.

MOB1B

Description MOB kinase activator 1B

Gene and Protein Information

Gene ID 92597
Uniprot Accession IDs Q7L9L4 B2R8U6 B4DRY3 Q8IY23
Ensembl ID ENSG00000173542
Symbol MOB4A MOBKL1A MATS2 MOB4A MOBKL1A
Chromosome 4
Family Belongs to the MOB1/phocein family.
Sequence
MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 741698 MOB1B MOB kinase activator 1B 9598 VGNC:13028 OMA, EggNOG
Macaque 705155 MOB1B MOB kinase activator 1B 9544 OMA, EggNOG
Mouse 68473 Mob1b MOB kinase activator 1B 10090 MGI:1915723 Inparanoid, OMA, EggNOG
Rat 360920 Mob1b MOB kinase activator 1B 10116 RGD:1305114 Inparanoid, OMA, EggNOG
Dog 482187 MOB1B MOB kinase activator 1B 9615 VGNC:43300 Inparanoid, OMA, EggNOG
Horse 100054658 MOB1B MOB kinase activator 1B 9796 VGNC:20247 Inparanoid, OMA
Cow 515407 MOB1B MOB kinase activator 1B 9913 VGNC:31542 Inparanoid, OMA
Opossum MOB1B MOB kinase activator 1B [Source:HGNC Symbol;Acc:HGNC:29801] 13616 OMA, EggNOG
Platypus MOB1B MOB kinase activator 1B [Source:HGNC Symbol;Acc:HGNC:29801] 9258 OMA, EggNOG
Chicken 422647 MOB1B MOB kinase activator 1B 9031 CGNC:8797 OMA, EggNOG
Anole lizard 100559197 mob1b MOB kinase activator 1B 28377 Inparanoid, OMA, EggNOG
Zebrafish 393169 mob1ba MOB kinase activator 1Ba 7955 ZDB-GENE-040426-919 Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    kinase activator    /    MOB kinase activator 1B
DTO Classes
protein    /    Enzyme modulator    /    Kinase modulator    /    Kinase activator    /    MOB kinase activator 1B

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.