JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

POU2AF1

Description	POU domain class 2-associating factor 1

Gene and Protein Information

Gene ID	5450
Uniprot Accession IDs	Q16633 B2R8Z9 Q14983
Ensembl ID	ENSG00000110777
Symbol	OBF1 BOB1 OBF1 OCAB OBF-1
Chromosome	11
Family	Belongs to the POU2AF1 family.
Sequence	MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	451537	POU2AF1	POU class 2 associating factor 1	9598	VGNC:1045	OMA, EggNOG
Macaque	709752	POU2AF1	POU class 2 associating factor 1	9544		OMA, EggNOG
Mouse	18985	Pou2af1	POU domain, class 2, associating factor 1	10090	MGI:105086	Inparanoid, OMA, EggNOG
Rat	690528	Pou2af1	POU class 2 associating factor 1	10116	RGD:1594728	Inparanoid, OMA, EggNOG
Dog	489413	POU2AF1	POU class 2 associating factor 1	9615	VGNC:44825	Inparanoid, OMA, EggNOG
Horse	100070302	POU2AF1	POU class 2 associating factor 1	9796	VGNC:21707	Inparanoid, OMA, EggNOG
Cow	528475	POU2AF1	POU class 2 associating factor 1	9913	VGNC:33173	Inparanoid, OMA, EggNOG
Pig	100512063	POU2AF1	POU class 2 associating factor 1	9823		Inparanoid, OMA, EggNOG
Opossum	100032355	POU2AF1	POU class 2 associating factor 1	13616		Inparanoid, OMA, EggNOG
Platypus	100089514	POU2AF1	POU class 2 associating factor 1	9258		Inparanoid, EggNOG
Anole lizard	100553601	pou2af1	POU class 2 associating factor 1	28377		Inparanoid, OMA, EggNOG
Xenopus	100496996	pou2af1	POU class 2 associating factor 1	8364	XB-GENE-854772	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.