JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

LAT

Description	Linker for activation of T-cells family member 1

Gene and Protein Information

Gene ID	27040
Uniprot Accession IDs	O43561 B7WPI0 C7C5T6 G5E9K3 O43919
Ensembl ID	ENSG00000213658
Symbol	LAT1 pp36 IMD52
Chromosome	16
Sequence	MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	743295	LAT	linker for activation of T-cells	9598		OMA, EggNOG
Mouse	16797	Lat	linker for activation of T cells	10090	MGI:1342293	Inparanoid, OMA, EggNOG
Rat	81511	Lat	linker for activation of T cells	10116	RGD:620802	Inparanoid, OMA, EggNOG
Dog	607947	LAT	linker for activation of T cells	9615	VGNC:42596	Inparanoid, OMA, EggNOG
Horse	100064430	LAT	linker for activation of T cells	9796	VGNC:19595	Inparanoid, OMA, EggNOG
Cow	514735	LAT	linker for activation of T cells	9913	VGNC:50054	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.