This is a demo store. No orders will be fulfilled.

KRT7

Description Keratin, type II cytoskeletal 7

Gene and Protein Information

Gene ID 3855
Uniprot Accession IDs P08729 Q92676 Q9BUD8 Q9Y3R7
Ensembl ID ENSG00000135480
Symbol SCL K7 CK7 SCL K2C7
Chromosome 12
Family Belongs to the intermediate filament family.
Sequence
MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 466983 KRT7 keratin 7 9598 VGNC:8451 Inparanoid, OMA, EggNOG
Macaque 697425 KRT7 keratin 7 9544 Inparanoid, OMA, EggNOG
Mouse 110310 Krt7 keratin 7 10090 MGI:96704 Inparanoid, OMA, EggNOG
Rat 300242 Krt7 keratin 7 10116 RGD:1310865 Inparanoid, OMA, EggNOG
Horse 100062790 KRT7 keratin 7 9796 VGNC:19536 Inparanoid, OMA, EggNOG
Cow 535697 KRT7 keratin 7 9913 VGNC:30734 Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.