JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

ACP1

Description	Low molecular weight phosphotyrosine protein phosphatase

Gene and Protein Information

Gene ID	52
Uniprot Accession IDs	P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 LMW-PTP
Ensembl ID	ENSG00000143727
Symbol	HAAP LMWPTP LMW-PTP
Chromosome	2
Family	Belongs to the low molecular weight phosphotyrosine protein phosphatase family.
Sequence	MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	458990	ACP1	acid phosphatase 1	9598	VGNC:48983	OMA, EggNOG
Mouse	11431	Acp1	acid phosphatase 1, soluble	10090	MGI:87881	Inparanoid, OMA, EggNOG
Rat	24161	Acp1	acid phosphatase 1	10116	RGD:2020	Inparanoid, OMA, EggNOG
Horse	100057408	ACP1	acid phosphatase 1	9796	VGNC:51272	Inparanoid, EggNOG
Cow	280977	ACP1	acid phosphatase 1	9913		Inparanoid, OMA, EggNOG
Pig	100737301	ACP1	acid phosphatase 1	9823		Inparanoid, OMA, EggNOG
Platypus	100080893	ACP1	acid phosphatase 1	9258		Inparanoid, EggNOG
Chicken	421909	ACP1	acid phosphatase 1, soluble	9031	CGNC:12245	Inparanoid, EggNOG
Anole lizard	100565351	acp1	acid phosphatase 1	28377		Inparanoid, EggNOG
Xenopus	448657	acp1	acid phosphatase 1	8364	XB-GENE-973004	Inparanoid, OMA, EggNOG
Zebrafish	541489	acp1	acid phosphatase 1	7955	ZDB-GENE-050327-12	Inparanoid, EggNOG
C. elegans	177055	Y94H6A.7	Uncharacterized protein	6239		OMA, EggNOG
S.cerevisiae	856187	LTP1	tyrosine protein phosphatase LTP1	4932	S000006277	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.