JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

PPP1R8

Description	Nuclear inhibitor of protein phosphatase 1

Gene and Protein Information

Gene ID	5511
Uniprot Accession IDs	Q12972 Q5TEJ2 Q5TEJ4 Q5TIF2 Q6PKF6 Q9UBH1 Q9UBZ0 NIPP-1
Ensembl ID	ENSG00000117751
Symbol	ARD1 NIPP1 ARD1 ARD-1 NIPP1 NIPP-1 PRO2047
Chromosome	1
Sequence	MAAAANSGSSLPLFDCPTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYHKHLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGDEKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	469247	PPP1R8	protein phosphatase 1 regulatory subunit 8	9598	VGNC:6961	OMA, EggNOG
Mouse	100336	Ppp1r8	protein phosphatase 1, regulatory (inhibitor) subunit 8	10090	MGI:2140494	Inparanoid, OMA, EggNOG
Rat	313030	Ppp1r8	protein phosphatase 1, regulatory subunit 8	10116	RGD:1306280	Inparanoid, OMA
Horse	100056729	PPP1R8	protein phosphatase 1 regulatory subunit 8	9796	VGNC:21771	Inparanoid, OMA, EggNOG
Cow	282319	PPP1R8	protein phosphatase 1 regulatory subunit 8	9913	VGNC:33249	Inparanoid, OMA, EggNOG
Pig	100627843	PPP1R8	protein phosphatase 1 regulatory subunit 8	9823		Inparanoid, OMA, EggNOG
Opossum	100014423	PPP1R8	protein phosphatase 1 regulatory subunit 8	13616		Inparanoid, OMA, EggNOG
Chicken	419564	PPP1R8	protein phosphatase 1 regulatory subunit 8	9031	CGNC:463	Inparanoid, OMA, EggNOG
Anole lizard	100555696	ppp1r8	protein phosphatase 1 regulatory subunit 8	28377		Inparanoid, OMA, EggNOG
Xenopus	549833	ppp1r8	protein phosphatase 1 regulatory subunit 8	8364	XB-GENE-479608	Inparanoid, OMA, EggNOG
Zebrafish	566830	ppp1r8a	protein phosphatase 1, regulatory subunit 8a	7955	ZDB-GENE-060503-681	OMA, EggNOG
C. elegans	172955	B0511.7	hypothetical protein	6239		Inparanoid, EggNOG
Fruitfly	44748	NiPp1	Nuclear inhibitor of Protein phosphatase 1	7227	FBgn0026402	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.