JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

PPP1R7

Description	Protein phosphatase 1 regulatory subunit 7

Gene and Protein Information

Gene ID	5510
Uniprot Accession IDs	Q15435 B4DFD4 B5MCY6 Q9UQE5 Q9UQE6 Q9Y6K4
Ensembl ID	ENSG00000115685
Symbol	SDS22 SDS22
Chromosome	2
Family	Belongs to the SDS22 family.
Sequence	MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	460079	PPP1R7	protein phosphatase 1 regulatory subunit 7	9598	VGNC:14345	OMA, EggNOG
Macaque	700574	PPP1R7	protein phosphatase 1 regulatory subunit 7	9544		Inparanoid, OMA, EggNOG
Mouse	66385	Ppp1r7	protein phosphatase 1, regulatory (inhibitor) subunit 7	10090	MGI:1913635	Inparanoid, OMA, EggNOG
Dog	100855698	PPP1R7	protein phosphatase 1 regulatory subunit 7	9615		Inparanoid, OMA
Horse	100067637	PPP1R7	protein phosphatase 1 regulatory subunit 7	9796	VGNC:52421	Inparanoid, OMA, EggNOG
Cow	505297	PPP1R7	protein phosphatase 1 regulatory subunit 7	9913	VGNC:52808	Inparanoid, OMA, EggNOG
Pig	100511842	PPP1R7	protein phosphatase 1 regulatory subunit 7	9823		Inparanoid, OMA, EggNOG
Platypus	100082676	PPP1R7	protein phosphatase 1 regulatory subunit 7	9258		Inparanoid, OMA, EggNOG
Anole lizard	100552255	ppp1r7	protein phosphatase 1 regulatory subunit 7	28377		Inparanoid, OMA, EggNOG
Xenopus	448394	ppp1r7	protein phosphatase 1 regulatory subunit 7	8364	XB-GENE-964679	Inparanoid, OMA, EggNOG
Zebrafish	560323	ppp1r7	protein phosphatase 1, regulatory (inhibitor) subunit 7	7955	ZDB-GENE-051113-288	Inparanoid, OMA, EggNOG
C. elegans	174266	sds-22	Protein phosphatase 1 regulatory subunit SDS22 homolog	6239		Inparanoid, OMA
Fruitfly	42091	sds22	CG5851 gene product from transcript CG5851-RA	7227	FBgn0028992	Inparanoid, EggNOG
S.cerevisiae	853641	SDS22	type 1 protein phosphatase-activating protein SDS22	4932	S000001676	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.